PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0765s0003.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family WRKY
Protein Properties Length: 376aa    MW: 41529.9 Da    PI: 5.0362
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0765s0003.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY1062e-33208265259
                          --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                 WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                          +Dgy+WrKYGqK vk+s+fprsYYrCtsa+C vkk+vers +dp++v++tYeg+H+h+
  Kalax.0765s0003.1.p 208 EDGYRWRKYGQKAVKNSPFPRSYYRCTSASCGVKKRVERSCTDPSIVVTTYEGQHTHP 265
                          8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.8E-34192267IPR003657WRKY domain
SuperFamilySSF1182904.71E-29199267IPR003657WRKY domain
PROSITE profilePS5081131.961202267IPR003657WRKY domain
SMARTSM007748.6E-39207266IPR003657WRKY domain
PfamPF031061.3E-26208265IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 376 aa     Download sequence    Send to blast
MMKKEAMENP VSGARNPSDT SLFYSDLQGV GAGYGSLCSM FDGMGNGAGG ELGFLEMLGV  60
QEFQVPMGYV FDETAHSREV MPSWQTATSI DQVAAVGDIE YHNGSLKPMS KQRQQFDDGN  120
NNAPGTPNSS SISSASNNEG VVVESDQQDK AEEDEEEEDI IGDEEEEEQD QQGSGKSKKQ  180
LKAKKANLKK QRQPRFAFMT KSEVDHLEDG YRWRKYGQKA VKNSPFPRSY YRCTSASCGV  240
KKRVERSCTD PSIVVTTYEG QHTHPSPLTP RSISSSIFPD SAAFAAMPAL MQMNLHSRYQ  300
QQLPSYFASP LNYSTYPIHS LTTSPAPNFN SFTPSPKNNL NVMSNPDQTF LRDHGLLQDL  360
IPSLLPKEEQ QRSSN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-272002671077Probable WRKY transcription factor 4
2lex_A1e-272002671077Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotO229004e-54WRK23_ARATH; Probable WRKY transcription factor 23
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.19e-48WRKY DNA-binding protein 23